ExactAntigen

Mouse Monoclonal anti-LEF1 (5A3) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00051176-M03
ProductName: LEF1 Antibody
Product Description: Mouse Monoclonal anti-LEF1 (5A3)
Clone: 5A3
Clonality: Monoclonal
Immunogen: LEF1 (NP_057353, 14 a.a. ~ 124 a.a) partial recombinant protein with GST tag.
Epitope: DPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNND* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background: Lymphoid enhancer-binding factor-1 (LEF1) is a 48-kD nuclear protein that is expressed in pre-B and T cells. It binds to a functionally important site in the T-cell receptor-alpha (TCRA; MIM 186880) enhancer and confers maximal enhancer activity. LEF1 belongs to a family of regulatory proteins that share homology with high mobility group protein-1 (HMG1; MIM 163905).[supplied by OMIM]
Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-DKFZp586H0919 antibody, anti-TCF1ALPHA antibody
ProteinTarget: lymphoid enhancer-binding factor 1
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 51176
Gene_Symbol: LEF1
Omim_ID: 153245,
more information: company product webpage
Also see:
see all human LEF1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about