ExactAntigen

LEF1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00051176-M01
Product Type:Primary Antibody
Product Name:LEF1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:51176
Host:Mouse
Clone:3H5
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-LEF1 (3H5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = LEF1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-LEF1 antibody, anti-lymphoid enhancer-binding factor 1antibody, anti-HGNC:6551 antibody, anti-DKFZp586H0919 antibody, anti-TCF1ALPHAantibody, anti-lymphoid enhancer binding factor-1 antibody
Immunogen:LEF1 (AAH50632, 1 a.a. ~ 400 a.a) full length recombinant protein with GST tag.
Epitope:MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHT ...
Specificity:LEF1 - lymphoid enhancer-binding factor 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:LEF1
Omim ID:153245
see all human LEF1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about