| request information: |
|
| Catalog Code: | H00051151-M02 |
| Product Name: | SLC45A2 Antibody |
| Product Description: | Mouse Monoclonal anti-SLC45A2 (1B2) |
| Clone: | 1B2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51151 |
| Gene Symbol: | SLC45A2 |
| Omim ID: | 606202, 606574, |
| Immunogen: | SLC45A2 (AAH03597, 1 a.a. ~ 244 a.a) full length recombinant protein with GST tag. |
| Epitope: | MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPI
LGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADF
IDGPIKAYLFDVCSHQDKEKGLHYHALFTDSQGNDIKVTAESTGEHASSLPLPLHQPPHWMDGLPVQHAVLHRFHGPDC
VPRGSL* |
| Specificity: | SLC45A2 - solute carrier family 45, member 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene encodes a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-1A1 antibody, anti-AIM1 antibody, anti-MATP antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |