| request information: |
|
| Catalog Code: | H00051131-B01 |
| Product Name: | PHF11 Antibody |
| Product Description: | Mouse Polyclonal anti-PHF11 - PHD finger protein 11, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 51131 |
| Gene Symbol: | PHF11 |
| Immunogen: | PHF11 (1 a.a. ~ 292 a.a) full-length human protein. |
| Epitope: | MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGA
TVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKC
NTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFV
NFQAAIEKKIHASQQRWQ |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-APY antibody, anti-BCAP antibody, anti-IGEL antibody, anti-IGER antibody, anti-IGHER antibody, anti-NY-REN-34 antibody, anti-NYREN34 antibody, anti-RP11-185C18.3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |