ExactAntigen

ANGPTL4 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00051129-A01
Product Name:ANGPTL4 Antibody
Product Description:Mouse Polyclonal anti-ANGPTL4
Clonality:Polyclonal
ListPrice:225
Gene ID:51129
Gene Symbol:ANGPTL4
Omim ID:605910,
Immunogen:ANGPTL4 (AAH23647, 26 a.a. ~ 407 a.a) full length recombinant protein with GST tag.
Epitope:GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHS
LQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHR
LPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKV
HSITGDRNSRLAVQLRDW
Specificity:ANGPTL4 - angiopoietin-like 4
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml Whole antisera Mouse antisera.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Background:This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. This gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. The encoded protein is a serum hormone directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity and also acts as an apoptosis survival factor for vascular endothelial cells. The encoded protein may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. Alternatively spliced transcript variants encoding different isoforms have been described. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-ANGPTL2 antibody, anti-ARP4 antibody, anti-FIAF antibody, anti-HFARP antibody, anti-PGAR antibody, anti-PPARG antibody, anti-pp1158 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human ANGPTL4 antibodies


2008©ExactAntigen home | browse | about