| request information: |
|
| Catalog Code: | H00051099-M02 |
| Product Name: | ABHD5 Antibody |
| Product Description: | Mouse Monoclonal anti-ABHD5 (4B12) |
| Clone: | 4B12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51099 |
| Gene Symbol: | ABHD5 |
| Omim ID: | 275630, 604780, |
| Immunogen: | ABHD5 (NP_057090, 240 a.a. ~ 343 a.a) partial recombinant protein with GST tag. |
| Epitope: | FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVK
TIAILGAGHYVYADQPEEFNQKVK* |
| Specificity: | ABHD5 - abhydrolase domain containing 5 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CDS antibody, anti-CGI58 antibody, anti-IECN2 antibody, anti-MGC8731 antibody, anti-NCIE2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |