ExactAntigen

Mouse Monoclonal anti-SPG3A - spastic paraplegia 3A (autosomal dominant) (1B11)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00051062-M10
ProductName:SPG3A Antibody
Product Description:Mouse Monoclonal anti-SPG3A - spastic paraplegia 3A (autosomal dominant) (1B11)
Clone:1B11
Clonality:Monoclonal
Immunogen:SPG3A (NP_056999, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV* ...
CrossReactivity:Human.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:The protein encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may be involved in axonal maintenance as evidenced by the fact that defects in this gene are a cause of spastic paraplegia type 3. Three transcript variants encoding two different isoforms have been found for this gene.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-AD-FSP antibody, anti-ATL1 antibody, anti-FSP1 antibody, anti-GBP3 antibody, anti-SPG3 antibody, anti-atlastin1 antibody
ProteinTarget:spastic paraplegia 3A (autosomal dominant)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:51062
Gene_Symbol:SPG3A
see all human SPG3A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about