| request information: |
|
| Catalog Code: | H00051062-M03 |
| Product Name: | SPG3A Antibody |
| Product Description: | Mouse Monoclonal anti-SPG3A (1B9) |
| Clone: | 1B9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51062 |
| Gene Symbol: | SPG3A |
| Omim ID: | 182600, 606439, |
| Immunogen: | SPG3A (NP_056999, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKG
KSFLMDFMLRYMYNQESVDWV* |
| Specificity: | SPG3A - spastic paraplegia 3A (autosomal dominant) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may be involved in axonal maintenance as evidenced by the fact that defects in this gene are a cause of spastic paraplegia type 3. Three transcript variants encoding two different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AD-FSP antibody, anti-ATL1 antibody, anti-FSP1 antibody, anti-GBP3 antibody, anti-SPG3 antibody, anti-atlastin1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |