| CatalogCode: | H00051062-A01 |
| ProductName: | SPG3A Antibody |
| Product Description: | Mouse Polyclonal anti-SPG3A |
| Clonality: | Polyclonal |
| Immunogen: | SPG3A (NP_056999, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV* ... |
| Specificity: | SPG3A - spastic paraplegia 3A (autosomal dominant) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may be involved in axonal maintenance as evidenced by the fact that defects in this gene are a cause of spastic paraplegia type 3. Three transcript variants encoding two different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-AD-FSP antibody, anti-ATL1 antibody, anti-FSP1 antibody, anti-GBP3 antibody, anti-SPG3 antibody, anti-atlastin1 antibody |
| ProteinTarget: | SPG3A - spastic paraplegia 3A (autosomal dominant) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 51062 |
| Gene_Symbol: | SPG3A |
| Omim_ID: | 182600, 606439, |