| request information: |
|
| Catalog Code: | H00051022-A01 |
| Product Name: | GLRX2 Antibody |
| Product Description: | Mouse Polyclonal anti-GLRX2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 51022 |
| Gene Symbol: | GLRX2 |
| Omim ID: | 606820 |
| Immunogen: | GLRX2 (AAH28113, 1 a.a. ~ 125 a.a) full length recombinant protein with GST tag. |
| Epitope: | MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGER
TVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ* |
| Specificity: | GLRX2 - glutaredoxin 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Glutaredoxins (e.g., GLRX; MIM 600443) are a family of glutathione-dependent hydrogen donors that participate in a variety of cellular redox reactions.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GRX2 antibody, anti-bA101E13.1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |