| request information: |
|
| Catalog Code: | H00051002-M01 |
| Product Name: | CGI-121 Antibody |
| Product Description: | Mouse Monoclonal anti-CGI-121 - CGI-121 protein (3F6) |
| Clone: | 3F6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 51002 |
| Gene Symbol: | CGI-121 |
| Immunogen: | CGI-121 (NP_057142, 66 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Epitope: | KLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITE
VKKIYKLSSQEESIGTLLDAIICRMSTKDVL* |
| Cross Reactivity: | Human. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |