| CatalogCode: | H00050855-A01 |
| ProductName: | PARD6A Antibody |
| Product Description: | Mouse Polyclonal anti-PARD6A |
| Clonality: | Polyclonal |
| Immunogen: | PARD6A (NP_058644, 247 a.a. ~ 347 a.a) partial recombinant protein with GST tag. |
| Epitope: | KPANQRNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL* ... |
| Specificity: | PARD6A - par-6 partitioning defective 6 homolog alpha (C.elegans) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-PAR-6 antibody, anti-PAR-6A antibody, anti-PAR6 antibody, anti-PAR6C antibody, anti-PAR6alpha antibody, anti-TAX40 antibody, anti-TIP-40 antibody |
| ProteinTarget: | PARD6A - par-6 partitioning defective 6 homolog alpha (C.elegans) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 50855 |
| Gene_Symbol: | PARD6A |
| Omim_ID: | 607484 H00050855-B01 |
order or
more information: | company product webpage |
| request information: |
|