ExactAntigen

NEUROG3 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00050674-M02
Product Name:NEUROG3 Antibody
Product Description:Mouse Monoclonal anti-NEUROG3 (4E9)
Clone:4E9
Clonality:Monoclonal
ListPrice:295
Gene ID:50674
Gene Symbol:NEUROG3
Omim ID:604882,
Immunogen:NEUROG3 (NP_066279, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGRSRPKSELALSK
QRRSRRKKANDRERNRMHNLN*
Specificity:NEUROG3 - neurogenin 3
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:Neurogenin-3 (NEUROG3) is expressed in endocrine progenitor cells and is required for endocrine cell development in the pancreas and intestine (Wang et al., 2006 [PubMed 16855267]). It belongs to a family of basic helix-loop-helix transcription factors involved in the determination of neural precursor cells in the neuroectoderm (Gradwohl et al., 2000 [PubMed 10677506]).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b Kappa
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-Atoh5 antibody, anti-Math4B antibody, anti-ngn3 antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human neurogenin 3 antibodies


2008©ExactAntigen home | browse | about