| request information: |
|
| Catalog Code: | H00050674-M02 |
| Product Name: | NEUROG3 Antibody |
| Product Description: | Mouse Monoclonal anti-NEUROG3 (4E9) |
| Clone: | 4E9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 50674 |
| Gene Symbol: | NEUROG3 |
| Omim ID: | 604882, |
| Immunogen: | NEUROG3 (NP_066279, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGRSRPKSELALSK
QRRSRRKKANDRERNRMHNLN* |
| Specificity: | NEUROG3 - neurogenin 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Neurogenin-3 (NEUROG3) is expressed in endocrine progenitor cells and is required for endocrine cell development in the pancreas and intestine (Wang et al., 2006 [PubMed 16855267]). It belongs to a family of basic helix-loop-helix transcription factors involved in the determination of neural precursor cells in the neuroectoderm (Gradwohl et al., 2000 [PubMed 10677506]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Atoh5 antibody, anti-Math4B antibody, anti-ngn3 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |