| request information: |
|
| Catalog Code: | H00050649-A01 |
| Product Name: | ARHGEF4 Antibody |
| Product Description: | Mouse Polyclonal anti-ARHGEF4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 50649 |
| Gene Symbol: | ARHGEF4 |
| Omim ID: | 605216, |
| Immunogen: | ARHGEF4 (NP_056135, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGEAPSQPRGIPHRSPVSVDDLWLEKTQRKKL
QKQAHVERRLHIGAVHKDGVK* |
| Specificity: | ARHGEF4 - Rho guanine nucleotide exchange factor (GEF) 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. This protein is similar to rat collybistin protein. Alternative splicing of this gene generates two transcript variants which encode different isoforms. Also there is possibility for the usage of multiple polyadenylation sites for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ASEF antibody, anti-GEF4 antibody, anti-STM6 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |