| request information: |
|
| Catalog Code: | H00050628-M01 |
| Product Name: | GEMIN4 Antibody |
| Product Description: | Mouse Monoclonal anti-GEMIN4 - gem (nuclear organelle) associated protein 4 (3E1) |
| Clone: | 3E1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 50628 |
| Gene Symbol: | GEMIN4 |
| Immunogen: | GEMIN4 (NP_056536, 959 a.a. ~ 1058 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Epitope: | AAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKS
IAEGIGPEERRQTLLQKMSS* |
| Cross Reactivity: | Human. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes required for pre-mRNA splicing in the nucleus. The encoded protein directly interacts with a DEAD box protein and several spliceosome core proteins. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZP434B131 antibody, anti-DKFZP434D174 antibody, anti-HC56 antibody, anti-HHRF-1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |