| request information: | |
| Catalog Code: | H00050628-A01 |
| Product Name: | GEMIN4 Antibody |
| Product Description: | Mouse Polyclonal anti-GEMIN4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 50628 |
| Gene Symbol: | GEMIN4 |
| Omim ID: | 606969, |
| Immunogen: | GEMIN4 (NP_056536, 959 a.a. ~ 1058 a.a) partial recombinant protein with GST tag. |
| Epitope: | AAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKS IAEGIGPEERRQTLLQKMSS* |
| Specificity: | GEMIN4 - gem (nuclear organelle) associated protein 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The product of this gene is part of a large complex localized to the cytoplasm, nucleoli, and to discrete nuclear bodies called Gemini bodies (gems). The complex functions in spliceosomal snRNP assembly in the cytoplasm, and regenerates spliceosomes required for pre-mRNA splicing in the nucleus. The encoded protein directly interacts with a DEAD box protein and several spliceosome core proteins. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZP434B131 antibody, anti-DKFZP434D174 antibody, anti-HC56 antibody, anti-HHRF-1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or more information: | company product webpage |