| request information: |
|
| Catalog Code: | H00050485-B01 |
| Product Name: | SMARCAL1 Antibody |
| Product Description: | Mouse Polyclonal anti-SMARCAL1-SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a-like 1, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 50485 |
| Gene Symbol: | SMARCAL1 |
| Omim ID: | 242900 |
| Immunogen: | SMARCAL1 (1 a.a. ~ 954 a.a) full-length human protein. |
| Epitope: | MSLPLTEEQRKKIEENRQKALARRAEKLLAEQHQRTSSGTSIAGNPFQAKQGPSQNFPRESCKPVSHGVIFKQQNLSSS
SNADQRPHDSHSFQAKGIWKKPEEMPTACPGHSPRSQMALTGISPPLAQSPPEVPKQQLLSYELGQGHAQASPEIRFTP
FANPTHKPLAKPKSSQETPAHSSGQPPRDAKLEAKTAKASPSGQNISYIHSSSESVTPRTEGRLQQKSGSSVQKGVNSQ
KGKCVRNGDRFQVLIGYN |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein shows sequence similarity to the E. coli RNA polymerase-binding protein HepA. Mutations in this gene are a cause of Schimke immunoosseous dysplasia (SIOD), an autosomal recessive disorder with the diagnostic features of spondyloepiphyseal dysplasia, renal dysfunction, and T-cell immunodeficiency. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-ARP antibody, anti-HHARP antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |