| request information: | |
| Catalog Code: | H00050484-M01 |
| Product Name: | RRM2B Antibody |
| Product Description: | Mouse Monoclonal anti-RRM2B (6C1) |
| Clone: | 6C1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 50484 |
| Gene Symbol: | RRM2B |
| Omim ID: | 604712, |
| Immunogen: | RRM2B (NP_056528, 3 a.a. ~ 85 a.a) partial recombinant protein with GST tag. |
| Epitope: | DPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKL KAD* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686M05248 antibody, anti-MGC102856 antibody, anti-MGC42116 antibody, anti-p53R2 antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |