ExactAntigen

Mouse Polyclonal anti-KCNIP1 - Kv channel interacting protein 1
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00030820-B01
ProductName:KCNIP1 Antibody
Product Description:Mouse Polyclonal anti-KCNIP1 - Kv channel interacting protein 1
Clone:Kv channel interacting protein 1
Clonality:Polyclonal
Immunogen:KCNIP1 (AAH50375, 1 a.a. ~ 217 a.a) full-length human protein.MW of the GST tag alone is 26 KDa.
Epitope:MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:295
AppSummary:WB, ELISA
SpeciesSummary:Hu
ALTnames:anti-KCHIP1 antibody, anti-MGC95 antibody, anti-VABP antibody
ProteinTarget:Kv channel interacting protein 1
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id:30820
Gene_Symbol:KCNIP1
see all human KCNIP1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about