| CatalogCode: | H00030816-M06 |
| ProductName: | ERVWE1 Antibody |
| Product Description: | Mouse Monoclonal anti-ERVWE1 (4F10) |
| Clone: | 4F10 |
| Clonality: | Monoclonal |
| Immunogen: | ERVWE1 (NP_055405, 116 a.a. ~ 216 a.a) partial recombinant protein with GST tag. |
| Epitope: | DGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLRTHTRLVSLFNTTLTGLHEVSAQNPTNCWICLPLNFRPYVSIPVPEQWNNFSTEINT* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of an HERV provirus on chromosome 7 that has inactivating mutations in the gag and pol genes. This gene is the envelope glycoprotein gene which appears to have been selectively preserved. The product of this gene, syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-Env-W antibody, anti-HERV-7q antibody, anti-HERV-W antibody, anti-HERV-W-ENV antibody, anti-HERVW antibody, anti-env antibody |
| ProteinTarget: | ERVWE1 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 30816 |
| Gene_Symbol: | ERVWE1 |
| Target_Reg: | endogenous retroviral family W, env(C7), member 1 (syncytin) |
| Omim_ID: | 604659, |
order or
more information: | company product webpage |
| request information: |
|