ExactAntigen

Mouse Polyclonal anti-SLC40A1 - solute carrier family 40 (iron-regulated transporter), member 1, MaxPab Antibody | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00030061-B01
ProductName: SLC40A1 Antibody
Product Description: Mouse Polyclonal anti-SLC40A1 - solute carrier family 40 (iron-regulated transporter), member 1, MaxPab Antibody
Clonality: Polyclonal
Immunogen: SLC40A1 (-, 1 a.a. ~ 571 a.a) full-length human protein.
Epitope: MTRAGDHNRQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVILCGIILMMVFLHKHELLTMYHGWVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDT ...
CrossReactivity: Human.
Packaging: 0.05 ml of mouse antisera with 50% glycerol.
Uses: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Background: The protein encoded by this gene is a cell membrane protein that may be involved in iron export from duodenal epithelial cells. Defects in this gene are a cause of hemochromatosis type 4 (HFE4).
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name: Mouse
ListPrice: 295
AppSummary: WB, ELISA
SpeciesSummary: Hu
ALTnames: anti-FPN1 antibody, anti-HFE4 antibody, anti-IREG1 antibody, anti-MST079 antibody, anti-MSTP079 antibody, anti-MTP1 antibody, anti-SLC11A3 antibody
ProteinTarget: solute carrier family 40 (iron-regulated transporter), member 1
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id: 30061
Gene_Symbol: SLC40A1
more information: company product webpage
Also see:
see all human SLC40A1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about