| CatalogCode: | | H00030061-B01 |
| ProductName: | | SLC40A1 Antibody |
| Product Description: | | Mouse Polyclonal anti-SLC40A1 - solute carrier family 40 (iron-regulated transporter), member 1, MaxPab Antibody |
| Clonality: | | Polyclonal |
| Immunogen: | | SLC40A1 (-, 1 a.a. ~ 571 a.a) full-length human protein. |
| Epitope: | | MTRAGDHNRQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVILCGIILMMVFLHKHELLTMYHGWVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDT ... |
| CrossReactivity: | | Human. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Background: | | The protein encoded by this gene is a cell membrane protein that may be involved in iron export from duodenal epithelial cells. Defects in this gene are a cause of hemochromatosis type 4 (HFE4). |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 295 |
| AppSummary: | | WB, ELISA |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-FPN1 antibody, anti-HFE4 antibody, anti-IREG1 antibody, anti-MST079 antibody, anti-MSTP079 antibody, anti-MTP1 antibody, anti-SLC11A3 antibody |
| ProteinTarget: | | solute carrier family 40 (iron-regulated transporter), member 1 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | | 30061 |
| Gene_Symbol: | | SLC40A1 |
| more information: | | company product webpage |