| request information: |
|
| Catalog Code: | H00029997-M03 |
| Product Name: | GLTSCR2 Antibody |
| Product Description: | Mouse Monoclonal anti-GLTSCR2 (5A8) |
| Clone: | 5A8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 29997 |
| Gene Symbol: | GLTSCR2 |
| Omim ID: | 605691, |
| Immunogen: | GLTSCR2 (NP_056525, 402 a.a. ~ 479 a.a) partial recombinant protein with GST tag. |
| Epitope: | KPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFK SFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL* |
| Specificity: | GLTSCR2 - glioma tumor suppressor candidate region gene 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Nucleus, nucleolus. |
| Background: | Interacts with HSV-1 early proteins ICP22 and ICP0. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PICT1 antibody, anti-Glioma tumor suppressor candidate region gene 2 protein antibody, anti-p60 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |