| request information: | |
| Catalog Code: | H00029978-M03 |
| Product Name: | UBQLN2 Antibody |
| Product Description: | Mouse Monoclonal anti-UBQLN2 (5F5) |
| Clone: | 5F5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 29978 |
| Gene Symbol: | UBQLN2 |
| Omim ID: | 300264, |
| Immunogen: | UBQLN2 (NP_038472, 555 a.a. ~ 625 a.a) partial recombinant protein with GST tag. |
| Epitope: | PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CHAP1 antibody, anti-CHAP1/DSK2 antibody, anti-Dsk2 antibody, anti-HRIHFB2157 antibody, anti-LIC-2 antibody, anti-N4BP4 antibody, anti-PLIC-2 antibody, anti-PLIC2 antibody, anti-RIHFB2157 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |