ExactAntigen

Ubiquilin 2 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00029978-A01
Product Name:Ubiquilin 2 Antibody
Product Description:Mouse Polyclonal anti-Ubiquilin 2
Clonality:Polyclonal
ListPrice:225
Gene ID:29978
Gene Symbol:UBQLN2
Omim ID:300264,
Immunogen:UBQLN2 (NP_038472, 555 a.a. ~ 625 a.a) partial recombinant protein with GST tag.
Epitope:PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS*
Specificity:ubiquilin 2
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml Mouse antisera.
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Background:This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-CHAP1 antibody, anti-CHAP1/DSK2 antibody, anti-Dsk2 antibody, anti-HRIHFB2157 antibody, anti-LIC-2 antibody, anti-N4BP4 antibody, anti-PLIC-2 antibody, anti-PLIC2 antibody, anti-RIHFB2157 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human UBQLN2 antibodies


2008©ExactAntigen home | browse | about