| request information: |
|
| Catalog Code: | H00029966-A01 |
| Product Name: | STRN3 Antibody |
| Product Description: | Mouse Polyclonal anti-STRN3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 29966 |
| Gene Symbol: | STRN3 |
| Immunogen: | STRN3 (NP_055389, 614 a.a. ~ 714 a.a) partial recombinant protein with GST tag. |
| Epitope: | TAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVA
FHSSKAYIASAGADALAKVFV* |
| Specificity: | STRN3 - striatin, calmodulin binding protein 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml Whole antisera Mouse antisera. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SG2NA antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |