| request information: |
|
| Catalog Code: | H00029945-A01 |
| Product Name: | ANAPC4 Antibody |
| Product Description: | Mouse Polyclonal anti-ANAPC4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 29945 |
| Gene Symbol: | ANAPC4 |
| Omim ID: | 606947 |
| Immunogen: | ANAPC4 (AAH59383, 651 a.a. ~ 750 a.a) partial recombinant protein with GST tag. |
| Epitope: | VVLKDTVGREGRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQYVAGNGFRK
VSCVLSSNLRHVRVFEMDIDD |
| Specificity: | ANAPC4 - anaphase promoting complex subunit 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The exact function of this gene product is not known. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-APC4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |