ExactAntigen

Mouse Monoclonal anti-ALG6 (2G11) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00029929-M09
ProductName: ALG6 Antibody
Product Description: Mouse Monoclonal anti-ALG6 (2G11)
Clone: 2G11
Clonality: Monoclonal
Immunogen: ALG6 (NP_037471, 25 a.a. ~ 115 a.a) partial recombinant protein with GST tag.
Epitope: SYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRT* ...
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody reactive against recombinant protein on ELISA. The antibody is also shown to be specific in Western blot against cell lysates.
Background: This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2a Kappa
Host_Name: Mouse
Buffer: In 1x PBS, pH 7.2
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ProteinTarget: asparagine-linked glycosylation 6 homolog (yeast, alpha-1,3-glucosyltransferase)
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 29929
Gene_Symbol: ALG6
Omim_ID: 603147, 604566,
more information: company product webpage
Also see:
see all human ALG6 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about