| CatalogCode: | | H00029929-M09 |
| ProductName: | | ALG6 Antibody |
| Product Description: | | Mouse Monoclonal anti-ALG6 (2G11) |
| Clone: | | 2G11 |
| Clonality: | | Monoclonal |
| Immunogen: | | ALG6 (NP_037471, 25 a.a. ~ 115 a.a) partial recombinant protein with GST tag. |
| Epitope: | | SYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRT* ... |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.1 mg IgG purified Mouse ascites. |
| Uses: | | Antibody reactive against recombinant protein on ELISA. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | | This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | IgG purified |
| Isotype: | | IgG2a Kappa |
| Host_Name: | | Mouse |
| Buffer: | | In 1x PBS, pH 7.2 |
| ListPrice: | | 295 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ProteinTarget: | | asparagine-linked glycosylation 6 homolog (yeast, alpha-1,3-glucosyltransferase) |
| PackageSize: | | 0.1 mg |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 29929 |
| Gene_Symbol: | | ALG6 |
| Omim_ID: | | 603147, 604566, |
| more information: | | company product webpage |