| CatalogCode: | | H00029929-A01 |
| ProductName: | | ALG6 Antibody |
| Product Description: | | Mouse Polyclonal anti-ALG6 |
| Clonality: | | Polyclonal |
| Immunogen: | | ALG6 (NP_037471, 25 a.a. ~ 115 a.a) partial recombinant protein with GST tag. |
| Epitope: | | SYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRT* ... |
| Specificity: | | ALG6 - asparagine-linked glycosylation 6 homolog (yeast, alpha-1,3-glucosyltransferase) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ProteinTarget: | | ALG6 - asparagine-linked glycosylation 6 homolog (yeast, alpha-1,3-glucosyltransferase) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 29929 |
| Gene_Symbol: | | ALG6 |
| Omim_ID: | | 603147 604566 |
| more information: | | company product webpage |