| request information: |
|
| Catalog Code: | H00029882-M01 |
| Product Name: | ANAPC2 Antibody |
| Product Description: | Mouse Monoclonal anti-ANAPC2 (8G2) |
| Clone: | 8G2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 29882 |
| Gene Symbol: | ANAPC2 |
| Omim ID: | 606946, |
| Immunogen: | ANAPC2 (NP_037498, 716 a.a. ~ 823 a.a) partial recombinant protein with GST tag. |
| Epitope: | IEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQE
LQGYLQKKVRDQQLVYSAGVYRLPKNCS* |
| Specificity: | ANAPC2 - anaphase promoting complex subunit 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the 26S proteasome. Biochemical studies have shown that the vertebrate APC contains eight subunits. The composition of the APC is highly conserved in organisms from yeast to humans. The product of this gene is a component of the complex and shares sequence similarity with a recently identified family of proteins called cullins, which may also be involved in ubiquitin-mediated degradation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-APC2 antibody, anti-RP11-350O14.5 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |