| CatalogCode: | H00029802-M08 |
| ProductName: | VPREB3 Antibody |
| Product Description: | Mouse Monoclonal anti-VPREB3 (4H8) |
| Clone: | 4H8 |
| Clonality: | Monoclonal |
| Immunogen: | VPREB3 (NP_037510, 24 a.a. ~ 124 a.a) partial recombinant protein with GST tag. |
| Epitope: | QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP* ... |
| Specificity: | VPREB3 - pre-B lymphocyte gene 3 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The VPREB3 gene product is the human homologue of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. The VPREB3 protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of VPREB3 is not known, but it may contribute to mu chain transport in pre-B cells. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-8HS20 antibody, anti-N27C7-2 antibody |
| ProteinTarget: | VPREB3 - pre-B lymphocyte gene 3 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 29802 |
| Gene_Symbol: | VPREB3 |
| Omim_ID: | 605017, |
order or
more information: | company product webpage |
| request information: |
|