| request information: |
|
| Catalog Code: | H00029802-B01 |
| Product Name: | VPREB3 Antibody |
| Product Description: | Mouse Polyclonal anti-VPREB3 - pre-B lymphocyte gene 3, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 29802 |
| Gene Symbol: | VPREB3 |
| Immunogen: | VPREB3 (1 a.a. ~ 123 a.a) full-length human protein. |
| Epitope: | MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHR
PADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| Background: | The VPREB3 gene product is the human homologue of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. The VPREB3 protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of VPREB3 is not known, but it may contribute to mu chain transport in pre-B cells. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-8HS20 antibody, anti-N27C7-2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |