| request information: |
|
| Catalog Code: | H00029802-A01 |
| Product Name: | VPREB3 Antibody |
| Product Description: | Mouse Polyclonal anti-VPREB3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 29802 |
| Gene Symbol: | VPREB3 |
| Omim ID: | 605017, |
| Immunogen: | VPREB3 (NP_037510, 24 a.a. ~ 124 a.a) partial recombinant protein with GST tag. |
| Epitope: | QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTI
SPVQPEDDADYYCSVGYGFSP* |
| Specificity: | VPREB3 - pre-B lymphocyte gene 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The VPREB3 gene product is the human homologue of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. The VPREB3 protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of VPREB3 is not known, but it may contribute to mu chain transport in pre-B cells. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-8HS20 antibody, anti-N27C7-2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |