| CatalogCode: | | H00029763-A01 |
| ProductName: | | protein kinase C and casein kinase substrate in neurons 3 Antibody |
| Product Description: | | Mouse Polyclonal anti-protein kinase C and casein kinase substrate in neurons 3 |
| Clonality: | | Polyclonal |
| Immunogen: | | PACSIN3 (NP_057307, 171 a.a. ~ 281 a.a) partial recombinant protein with GST tag. |
| Epitope: | | ESHAKADSAVSQEQLRKLQERVERCAKEAEKTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQRLLFFKDMLLTLHQHLDLSSSEKFHELHRDLHQGIEAASDEED* ... |
| Specificity: | | protein kinase C and casein kinase substrate in neurons 3 |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ProteinTarget: | | protein kinase C and casein kinase substrate in neurons 3 |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 29763 |
| Gene_Symbol: | | PACSIN3 |
| Omim_ID: | | 606513, |
| more information: | | company product webpage |