| Catalog Code: | H00029128-M02 |
| Product Type: | Primary Antibody |
| Product Name: | UHRF1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 29128 |
| Host: | Mouse |
| Clone: | 3B12 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-UHRF1 - ubiquitin-like, containing PHD and RING finger domains, 1 (3B12) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 |
| Alternate Names: | anti-FLJ21925 antibody, anti-ICBP90 antibody, anti-Np95 antibody, anti-RNF106 antibody, anti-huNp95 antibody |
| Immunogen: | UHRF1 (NP_037414, 694 a.a. ~ 794 a.a) partial recombinant protein with GST tag. |
| Epitope: | WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is |
| Gene Symbol: | UHRF1 |