ExactAntigen

UHRF1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00029128-M02
Product Type:Primary Antibody
Product Name:UHRF1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:29128
Host:Mouse
Clone:3B12
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-UHRF1 - ubiquitin-like, containing PHD and RING finger domains, 1 (3B12)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2
Alternate Names:anti-FLJ21925 antibody, anti-ICBP90 antibody, anti-Np95 antibody, anti-RNF106 antibody, anti-huNp95 antibody
Immunogen:UHRF1 (NP_037414, 694 a.a. ~ 794 a.a) partial recombinant protein with GST tag.
Epitope:WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is
Gene Symbol:UHRF1
see all human ICBP90 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about