ExactAntigen

UHRF1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00029128-M01
Product Type:Primary Antibody
Product Name:UHRF1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:29128
Host:Mouse
Clone:3A11
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-UHRF1 (3A11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = UHRF1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-UHRF1 antibody, anti-ubiquitin-like antibody, anti-containing PHD and RING finger domains antibody, anti-1 antibody, anti-Np95 antibody, anti-ICBP90 antibody, anti-FLJ21925 antibody, anti-transcription factor ICBP90 antibody, anti-RNF106 antibody, an
Immunogen:UHRF1 (NP_037414, 694 a.a. ~ 794 a.a) partial recombinant protein with GST tag.
Epitope:WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR* ...
Specificity:UHRF1 - ubiquitin-like, containing PHD and RING finger domains, 1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:UHRF1
Omim ID:607990
see all human ICBP90 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about