ExactAntigen

UHRF1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00029128-A01
Product Type:Primary Antibody
Product Name:UHRF1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:29128
Host:Mouse
Product Description:Mouse Polyclonal anti-UHRF1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2
Alternate Names:anti-UHRF1 antibody, anti-ubiquitin-like antibody, anti-containing PHD and RING finger domains antibody, anti-1 antibody, anti-Np95 antibody, anti-ICBP90 antibody, anti-FLJ21925 antibody, anti-transcription factor ICBP90 antibody, anti-RNF106 antibody, an
Immunogen:UHRF1 (NP_037414, 694 a.a. ~ 794 a.a) partial recombinant protein with GST tag.
Epitope:WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR* ...
Specificity:UHRF1 - ubiquitin-like, containing PHD and RING finger domains, 1
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:UHRF1
Omim ID:607990
see all human ICBP90 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about