| Catalog Code: | H00029128-A01 |
| Product Type: | Primary Antibody |
| Product Name: | UHRF1 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 29128 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-UHRF1 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 |
| Alternate Names: | anti-UHRF1 antibody, anti-ubiquitin-like antibody, anti-containing PHD and RING finger domains antibody, anti-1 antibody, anti-Np95 antibody, anti-ICBP90 antibody, anti-FLJ21925 antibody, anti-transcription factor ICBP90 antibody, anti-RNF106 antibody, an |
| Immunogen: | UHRF1 (NP_037414, 694 a.a. ~ 794 a.a) partial recombinant protein with GST tag. |
| Epitope: | WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR* ... |
| Specificity: | UHRF1 - ubiquitin-like, containing PHD and RING finger domains, 1 |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | UHRF1 |
| Omim ID: | 607990 |