| CatalogCode: | H00029104-M01 |
| ProductName: | HEMK2 Antibody |
| Product Description: | Mouse Monoclonal anti-HEMK2 (1C4) |
| Clone: | 1C4 |
| Clonality: | Monoclonal |
| Immunogen: | HEMK2 (NP_877426, 87 a.a. ~ 187 a.a) partial recombinant protein with GST tag. |
| Epitope: | LETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS* ... |
| Specificity: | HEMK2 - HemK methyltransferase family member 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-C21orf127 antibody, anti-MGC19995 antibody, anti-MTQ2 antibody, anti-N6AMT1 antibody, anti-PRED28 antibody |
| ProteinTarget: | HEMK2 - HemK methyltransferase family member 2 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 29104 |
| Gene_Symbol: | HEMK2 |