| CatalogCode: | H00029104-B01 |
| ProductType: | Primary Antibody |
| ProductName: | HEMK2 Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 29104 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-HEMK2 - HemK methyltransferase family member 2, MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. |
| ALTnames: | anti-C21orf127 antibody, anti-MGC19995 antibody, anti-MTQ2 antibody, anti-N6AMT1 antibody, anti-PRED28 antibody |
| Immunogen: | HEMK2 (-, 1 a.a. ~ 186 a.a) full-length human protein. |
| Epitope: | MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |