| request information: |
|
| Catalog Code: | H00029097-M01 |
| Product Name: | HSPC163 Antibody |
| Product Description: | Mouse Monoclonal anti-HSPC163 (4E10-1G4) |
| Clone: | 4E10-1G4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 29097 |
| Gene Symbol: | CNIH4 |
| Immunogen: | HSPC163 (AAH00573, 1 a.a. ~ 140 a.a) full length recombinant protein with GST tag. |
| Epitope: | MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVAT
WNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND* |
| Specificity: | CNIH4 - HSPC163 protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |