ExactAntigen

Mouse Monoclonal anti-C20orf30 (3A5-1C3) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00029058-M02
ProductName: C20orf30 Antibody
Product Description: Mouse Monoclonal anti-C20orf30 (3A5-1C3)
Clone: 3A5-1C3
Clonality: Monoclonal
Immunogen: C20orf30 (AAH09768, 1 a.a. ~ 185 a.a) full length recombinant protein with GST tag.
Epitope: MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD* ...
Specificity: C20orf30 - chromosome 20 open reading frame 30
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody reactive against recombinant protein on ELISA.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA
SpeciesSummary: Hu
ALTnames: anti-HSPC274 antibody
ProteinTarget: C20orf30 - chromosome 20 open reading frame 30
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 29058
Gene_Symbol: C20orf30
more information: company product webpage
Also see:
see all human C20orf30 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about