| request information: |
|
| Catalog Code: | H00028511-M02 |
| Product Name: | NKIRAS2 Antibody |
| Product Description: | Mouse Monoclonal anti-NKIRAS2 (2G9) |
| Clone: | 2G9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 28511 |
| Gene Symbol: | NKIRAS2 |
| Omim ID: | 604497, |
| Immunogen: | NKIRAS2 (AAH07450, 1 a.a. ~ 192 a.a) full length recombinant protein with GST tag. |
| Epitope: | MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCT
DGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLL
EPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG* |
| Specificity: | NKIRAS2 - NFKB inhibitor interacting Ras-like 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Ascites |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZP434N1526 antibody, anti-KBRAS2 antibody, anti-MGC74742 antibody, anti-kappaB-Ras2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |