| request information: |
|
| Catalog Code: | H00028227-B01 |
| Product Name: | PPP2R3B Antibody |
| Product Description: | Mouse Polyclonal anti-PPP2R3B |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 28227 |
| Gene Symbol: | PPP2R3B |
| Omim ID: | 300339, |
| Immunogen: | PPP2R3B (AAH11180, 1 a.a. ~ 226 a.a) full-length human protein. |
| Epitope: | MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAI
EALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAE
EYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL* |
| Specificity: | Mouse polyclonal antibody raised against a full-length human PPP2R3B protein. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on transfected lysate. Abnova's recommended working dilutions for western analysis are as follows: 1:500-1:1000 for polysera |
| Background: | Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-NY-REN-8 antibody, anti-PPP2R3L antibody, anti-PPP2R3LY antibody, anti-PR48 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |