ExactAntigen

Mouse Polyclonal anti-PCLO - piccolo (presynaptic cytomatrix protein), MaxPab Antibody | Novus Biologicals antibody product information
CatalogCode:H00027445-B01
ProductName:PCLO Antibody
Product Description:Mouse Polyclonal anti-PCLO - piccolo (presynaptic cytomatrix protein), MaxPab Antibody
Clonality:Polyclonal
Immunogen:PCLO (-, 1 a.a. ~ 356 a.a) full-length human protein.
Epitope:MKKFRVSLVSKVGKQKYVDLNMLSDSENSQHLELHEPPKAVDKAKSPGVDPKQLAAELQKVSLQQSPLVLSSVVEKGSHVHSGPTSAGSSSVPSPGQPGSPSVSKKKHGSSKPTDGTKVVSHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGAEYKRRTKHVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTAHLDNTPRWYPLKEQTESIDH ...
CrossReactivity:Human.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Background:Synaptic vesicles dock and fuse in the active zone of the plasma membrane at chemical synapses. The presynaptic cytoskeletal matrix (PCM), which is associated with the active zone and is situated between synaptic vesicles, is thought to be involved in maintaining the neurotransmitter release site in register with the postsynaptic reception apparatus. The cycling of synaptic vesicles is a multistep process involving a number of proteins (see MIM 603215). Among the components of the PCM that orchestrate these events are Bassoon (BSN; MIM 604020), RIM (RBBP8; MIM 604124), Oboe, and Piccolo (PCLO).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:295
AppSummary:WB, ELISA
SpeciesSummary:Hu
ALTnames:anti-ACZ antibody, anti-DKFZp779G1236 antibody
ProteinTarget:piccolo (presynaptic cytomatrix protein)
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id:27445
Gene_Symbol:PCLO
order or
more information
:
company product webpage
request information:
Also see:
all human PCLO antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about