| Catalog Code: | H00027339-M07 |
| Product Type: | Primary Antibody |
| Product Name: | PRPF19 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 27339 |
| Host: | Mouse |
| Clone: | 2E5 |
| Product Description: | Mouse Monoclonal anti-PRPF19 (2E5) |
| Species Summary: | Hu, Mu, Rt |
| Background: | In S. cerevisiae, Pso4 has pleiotropic functions in DNA recombination and in error-prone nonhomologous end-joining DNA repair. |
| Alternate Names: | anti-NMP200 antibody, anti-PRP19 antibody, anti-PSO4 antibody, anti-UBOX4 antibody, anti-hPSO4 antibody |
| Immunogen: | PRPF19 (NP_055317, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF* ... |
| Purity: | protein A purified |
| Buffer: | 1x PBS, pH 7.2 |
| Packaging: | 0.1 ml protein A purified Mouse ascites. |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PRPF19 |
| Omim ID: | 608330, |
|