ExactAntigen

PRPF19 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00027339-M07
Product Type:Primary Antibody
Product Name:PRPF19 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:27339
Host:Mouse
Clone:2E5
Product Description:Mouse Monoclonal anti-PRPF19 (2E5)
Species Summary:Hu, Mu, Rt
Background:In S. cerevisiae, Pso4 has pleiotropic functions in DNA recombination and in error-prone nonhomologous end-joining DNA repair.
Alternate Names:anti-NMP200 antibody, anti-PRP19 antibody, anti-PSO4 antibody, anti-UBOX4 antibody, anti-hPSO4 antibody
Immunogen:PRPF19 (NP_055317, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag.
Epitope:MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF* ...
Purity:protein A purified
Buffer:1x PBS, pH 7.2
Packaging:0.1 ml protein A purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PRPF19
Omim ID:608330,
see all human PRPF19 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about