| request information: |
|
| Catalog Code: | H00027339-A01 |
| Product Name: | PRPF19 Antibody |
| Product Description: | Mouse Polyclonal anti-PRPF19 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 27339 |
| Gene Symbol: | PRPF19 |
| Omim ID: | 608330 |
| Immunogen: | PRPF19 (NP_055317, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQ
DEWDAVMLHSF* |
| Specificity: | PRPF19 - PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | In S. cerevisiae, Pso4 has pleiotropic functions in DNA recombination and in error-prone nonhomologous end-joining DNA repair.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-NMP200 antibody, anti-PRP19 antibody, anti-PSO4 antibody, anti-UBOX4 antibody, anti-hPSO4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |