| Catalog Code: | H00027334-B01 |
| Product Type: | Primary Antibody |
| Product Name: | P2RY10 Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 27334 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-P2RY10 - purinergic receptor P2Y, G-protein coupled, 10, MaxPab Antibody |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene belongs to the family of G-protein coupled receptors, that are preferentially activated by adenosine and uridine nucleotides. Two alternatively spliced transcript variants encoding the same protein isoform have been found |
| Alternate Names: | anti-P2Y10 antibody |
| Immunogen: | P2RY10 (AAH51875, 1 a.a. ~ 340 a.a) full-length human protein. |
| Epitope: | MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFIC ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |