ExactAntigen

Mouse Monoclonal anti-GOLPH4 (5E11)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00027333-M01
ProductName:GOLPH4 Antibody
Product Description:Mouse Monoclonal anti-GOLPH4 (5E11)
Clone:5E11
Clonality:Monoclonal
Immunogen:GOLPH4 (NP_055313, 473 a.a. ~ 569 a.a) partial recombinant protein with GST tag.
Epitope:HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-GIMPC antibody, anti-GPP130 antibody, anti-P138 antibody
ProteinTarget:golgi phosphoprotein 4
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:27333
Gene_Symbol:GOLPH4
Omim_ID:606805,
see all human GOLIM4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about