| Catalog Code: | H00027330-M05A |
| Product Type: | Primary Antibody |
| Product Name: | RPS6KA6 Antibody |
| List Price: | 295 |
| Clonality: | Monoclonal |
| Gene ID: | 27330 |
| Host: | Mouse |
| Clone: | 3E2 |
| Isotype: | IgG3 Kappa |
| Product Description: | Mouse Monoclonal anti-RPS6KA6 - ribosomal protein S6 kinase, 90kDa, polypeptide 6 (3E2) |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Alternate Names: | anti-RSK4 antibody |
| Immunogen: | RPS6KA6 (-, 636 a.a. ~ 746 a.a) partial recombinant protein with GST tag. |
| Epitope: | RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Preservative: | No Preservative |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| PackageSize: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, , Western Blot 1:500 |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |