ExactAntigen

RPS6KA6 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00027330-M05A
Product Type:Primary Antibody
Product Name:RPS6KA6 Antibody
List Price:295
Clonality:Monoclonal
Gene ID:27330
Host:Mouse
Clone:3E2
Isotype:IgG3 Kappa
Product Description:Mouse Monoclonal anti-RPS6KA6 - ribosomal protein S6 kinase, 90kDa, polypeptide 6 (3E2)
Cross Reactivity:Human.
Species Summary:Hu(+)
Alternate Names:anti-RSK4 antibody
Immunogen:RPS6KA6 (-, 636 a.a. ~ 746 a.a) partial recombinant protein with GST tag.
Epitope:RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Packaging:0.1 mg IgG purified Mouse ascites.
PackageSize:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, , Western Blot 1:500
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human RSK4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about