| request information: |
|
| Catalog Code: | H00027330-M02 |
| Product Name: | RPS6KA6 Antibody |
| Product Description: | Mouse Monoclonal anti-RPS6KA6 (6F2) |
| Clone: | 6F2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 27330 |
| Gene Symbol: | RPS6KA6 |
| Omim ID: | 300303, |
| Immunogen: | RPS6KA6 (636 a.a. ~ 746 a.a) partial recombinant protein with GST tag. |
| Epitope: | RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQI LKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTF QPVLEPVAASSLAQRRSMKKRTSTGL* |
| Specificity: | RPS6KA6 - ribosomal protein S6 kinase, 90kDa, polypeptide 6 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | RSK4 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-RSK4 antibody, anti-p90-RSK 6 antibody, anti-ribosomal protein S6 kinase 90kDa polypeptide 6 antibody, anti-Ribosomal protein S6 kinase alpha-6 antibody, anti-Ribosomal S6 kinase 4 antibody, anti-RPS6KA6 antibody, anti-RSK-4 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |