| request information: |
|
| Catalog Code: | H00027293-M01 |
| Product Name: | SMPDL3B Antibody |
| Product Description: | Mouse Monoclonal anti-SMPDL3B (5E12) |
| Clone: | 5E12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 27293 |
| Gene Symbol: | SMPDL3B |
| Immunogen: | SMPDL3B (NP_001009568, 274 a.a. ~ 373 a.a) partial recombinant protein with GST tag. |
| Epitope: | FFGHHHTDSFRMLYDDAGVPISAMFITPGVTPWKTTLPGVVNGANNPAIRVFEYDRATLSLKVRSPAEARGGGWEGLKC
ITTFPHSQLIHLPLTTEPQE* |
| Specificity: | SMPDL3B - sphingomyelin phosphodiesterase, acid-like 3B |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG3 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ASML3B antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |